Protein Info for Pf6N2E2_6064 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-methylaconitate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 317 to 340 (24 residues), see Phobius details TIGR02334: probable AcnD-accessory protein PrpF" amino acids 5 to 395 (391 residues), 757.3 bits, see alignment E=1.4e-232 PF04303: PrpF" amino acids 6 to 392 (387 residues), 576.2 bits, see alignment E=1.4e-177

Best Hits

Swiss-Prot: 85% identical to PRPF_CUPNE: 2-methyl-aconitate isomerase from Cupriavidus necator

KEGG orthology group: K09788, hypothetical protein (inferred from 99% identity to pba:PSEBR_a3955)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZU09 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Pf6N2E2_6064 2-methylaconitate isomerase (Pseudomonas fluorescens FW300-N2E2)
MAHAPQIRIPATYMRGGTSKGVFFSLQDLPEAARVPGTARDALLLRVIGSPDPYEKQIDG
MGGATSSTSKTVILSKSTRADHDVDYLFGQVSIDKPFVDWSGNCGNLSAAVGSFAISSGL
VDAGRIPQNGVAVVRIWQANIGKTIIAHVPITDGAVQETGDFELDGVTFPAAEVQLEFMD
PAAEEEGGGGSMFPTGNLVDDLEVPGVGTFKATLINAGIPTIFINARDVGYIGTELQGAI
NGDPKALAMFETIRAHGALRMGLIKHLDEAAQRQHTPKVAFVAPPADYVSSSGKAVAAGD
VDLLVRALSMGKLHHAMMGTAAVAIGTAAAISGTVVNLAAGGVERNAVRFGHPSGTLRVG
AEASQVNGEWTVKKAIMSRSARVLMEGFVRVPGQALS