Protein Info for Pf6N2E2_6058 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG139976: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 303 to 320 (18 residues), see Phobius details amino acids 325 to 342 (18 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 405 to 423 (19 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details PF14400: Transglut_i_TM" amino acids 16 to 175 (160 residues), 160.6 bits, see alignment E=3.2e-51 PF14402: 7TM_transglut" amino acids 251 to 496 (246 residues), 327.8 bits, see alignment E=4.5e-102

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a3961)

Predicted SEED Role

"FIG139976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZTY0 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Pf6N2E2_6058 FIG139976: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MLIAILVVLGLSVTAYQIFVLGIPVTEDATDDLWNIDAKVEFVPNAKDPVKIQMFVPPLS
RDYVSLNESFISNNYGVAVNRVDGNRKVTWSARRAKGNQTLYYRLVLTKRYSAEKTKVKG
PTFRDSIAVEGPEKLAAEALLAPIRQHSADVETFISEAIKRVNNLNDDNVKLLLAGDPSS
ANKARIVELVLSIAHVPVEKVHTIRLVAEQPQTPELWLRSFNGTDWLYFNPDTGEQGLPT
DRLLWWTGDENLITVDGGKKATVTFSMNNSEMNAIRLAKLTDENTDANFLEYSLYGLPLQ
TQQTFMIMVMIPIGVLVILILRNLIGLQTLGTFTPVLIALAFRETQLGFGIILFTVITTL
GLSLRSYLEHLKLQMLPRLSVVLTFVVVLIAAISLFSHKLGLERGLSVALFPMVILTMTI
ERLSITWEERGAGHAMKVAIGTLFAASLAHLIMSVPELVYFVFTFPAILLILVGFMLAMG
RYRGYRLTELVRFKAFLKADS