Protein Info for Pf6N2E2_605 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG002465: BNR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF02012: BNR" amino acids 78 to 87 (10 residues), 13.1 bits, see alignment (E = 2e-05) PF14870: PSII_BNR" amino acids 83 to 133 (51 residues), 31 bits, see alignment 4.1e-11 amino acids 133 to 259 (127 residues), 63.7 bits, see alignment E=4.4e-21 PF15899: BNR_6" amino acids 247 to 260 (14 residues), 17 bits, see alignment (E = 1.2e-06)

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3271)

Predicted SEED Role

"FIG002465: BNR repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YVB4 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Pf6N2E2_605 FIG002465: BNR repeat protein (Pseudomonas fluorescens FW300-N2E2)
MAVGRSRPPMLRRVALLASALSLLGSAVLSAPVMAVAASTSDVIYSVESAKASKTLMLDV
VHAGQRLVAVGDRGHIVYSDDQGKSWTQAKVPTRQLLTAVFFVDDKHGWAVGHDAQILAS
DDAGSTWTKQFEDLTREAPLLDVWFKDANNGFAVGAYGALLETTDGGKHWEDASDRLENE
DQFHLNAIAAVKDAGLFIVGEAGSMFRSADWGQTWEKVEGPYEGSLFGVIGTAQPSTLLA
YGLRGNLYRSTDFGGTWDQIELKAARGALEFGLSGATLLADGSIVIVGNGGSVVRSTDDG
ETFSVFNRPDRISVAAVTTAGNGNLILAGQGGVRATTSTGAELSK