Protein Info for Pf6N2E2_6049 in Pseudomonas fluorescens FW300-N2E2

Annotation: hydrolase, haloacid dehalogenase-like family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00702: Hydrolase" amino acids 11 to 189 (179 residues), 95.2 bits, see alignment E=1.1e-30 PF13419: HAD_2" amino acids 14 to 195 (182 residues), 82.6 bits, see alignment E=5.5e-27 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 82 to 194 (113 residues), 58.3 bits, see alignment E=1e-19 PF13242: Hydrolase_like" amino acids 151 to 204 (54 residues), 23.2 bits, see alignment E=8.2e-09

Best Hits

Swiss-Prot: 45% identical to HDHD1_HUMAN: Pseudouridine-5'-phosphatase (PUDP) from Homo sapiens

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3970)

Predicted SEED Role

"hydrolase, haloacid dehalogenase-like family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZTU3 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Pf6N2E2_6049 hydrolase, haloacid dehalogenase-like family (Pseudomonas fluorescens FW300-N2E2)
MNAPLKEFGPIKAVIFDMDGLLLDTEGIYTEVTSIIAERYGRTFDWSVKQNIIGRGATDL
ANYVVQALELPITPEEFLVIREPLMRERFPHALGMPGAEELVRHLKAHNVPIAVGTSSSS
PTFALKTTLHRDWFALFDFIVTADDPEVGAAKPAPDIFLTAARRLGVDPRDCLVFEDSPF
GVTAAKAAGMTAIAIPDSAMADEKYAHADGIIRSLKMFQPSLCGLPELEWA