Protein Info for Pf6N2E2_6039 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable lipoprotein signal peptide

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF12740: PETase" amino acids 65 to 176 (112 residues), 31.6 bits, see alignment E=3.1e-11 PF00561: Abhydrolase_1" amino acids 80 to 183 (104 residues), 26.5 bits, see alignment E=1.2e-09 PF12697: Abhydrolase_6" amino acids 82 to 293 (212 residues), 28.3 bits, see alignment E=6.8e-10 PF00326: Peptidase_S9" amino acids 97 to 185 (89 residues), 27.5 bits, see alignment E=5.6e-10

Best Hits

KEGG orthology group: None (inferred from 88% identity to pba:PSEBR_a3976)

Predicted SEED Role

"Probable lipoprotein signal peptide"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZTP4 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Pf6N2E2_6039 Probable lipoprotein signal peptide (Pseudomonas fluorescens FW300-N2E2)
LKTAFGALLLACLTTTALADENPVGFQSSTLSDPHNGRALEMVVWYPGATTETAQLIADN
AVFVGASAVRNAPPTAGEHPLVVLSHGYRGNWSNQIWLASALAHKGYIVAAVNHPGSTTH
DRSPQAAAQLWLRPVDLRRAIDAVTTQPEKFGRVANGRIAAVGHSLGGWTALEIAGARFD
PERFAQDCSTHPQLASCTVYEQMNPAGTAESKAELSAAWRDKRVTAVVTLDLGLSRGLTD
KSLAALPIPALVIAAGVPSQELPAELESANLAKRLPPASSRYIEISDASHFSFMSMCKPG
AEEMLEEEVPGDGIICRDGDGGRAREVIQQQVASLIAEFLAQSPADKKASL