Protein Info for Pf6N2E2_6013 in Pseudomonas fluorescens FW300-N2E2

Annotation: Conserved hypothetical phage protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 352 (336 residues), 89 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4000)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GU98 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Pf6N2E2_6013 Conserved hypothetical phage protein (Pseudomonas fluorescens FW300-N2E2)
MPPLSNGRPSNRFGLFCVASFLLSISYGATFLISLLVSSLGGTERDAGQVFAVAMTSTLV
AVVASGHLMQRVGAALCVALGAVFLVIASMGFALLSDLGIGLLACGLMLGIGWGLFYTVG
PIMVAAMVEPSRRTHCFALLSGSMLTGIGSGPLSGKLASSVGLPIQTAFFFAAAAALLGG
LYFWWLRTGFAEVERRSGDKARMGLRSATDVLRSRSALSILMVGLGGAIFGGLGSFQTSY
AASQGLDYSLFFVGFMGAAIACRLLIAGWVVSRDPLATSCLLTTLMLVAVTGFGVWVHDS
LSYGVTAALLGVGYGLNYSVINGLAANEAPPGLTAQALLLFSLSYFIGVFGFPFIAGKLI
SSTGVNGMLLSVGLIALLAWALSVSRWLAGRFWKPAFSE