Protein Info for Pf6N2E2_601 in Pseudomonas fluorescens FW300-N2E2

Annotation: GlpG protein (membrane protein of glp regulon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 87 to 107 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF16733: NRho" amino acids 1 to 66 (66 residues), 96.2 bits, see alignment E=1e-31 PF01694: Rhomboid" amino acids 138 to 280 (143 residues), 102.4 bits, see alignment E=2.4e-33

Best Hits

KEGG orthology group: K02441, GlpG protein (inferred from 99% identity to pba:PSEBR_a3275)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTU3 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Pf6N2E2_601 GlpG protein (membrane protein of glp regulon) (Pseudomonas fluorescens FW300-N2E2)
MSVVAVLRLPLAADLSGFVKLLQRMQVPHRVSEEAGEQVLWVPDEISEDVRSLYARFPAG
DPDQQLELPNTGGTSRRAGFVQQLTRSPVTAVVLLLSLIVSAVTLLGENLEILRWLTFLE
FRVVGDYIQFTPLADSLAAGQWWRLVTPMLIHFGFLHIAMNGMWYWELGRRIEARQGGIN
LLGLTLLFSLVSNFAQYFFSGPTLFGGLSGVLYGLLGHCWIYQLLAPNPAYHLPRGVLVM
MLVWLLLCLSGLVSLIGFGEIANAAHVGGLLVGCFTGLLGGLFARRKMAL