Protein Info for Pf6N2E2_5992 in Pseudomonas fluorescens FW300-N2E2

Annotation: Collagenase and related proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01852: START" amino acids 13 to 195 (183 residues), 43.6 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 58% identical to Y1579_PSEAE: Uncharacterized protein PA1579 (PA1579) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4012)

Predicted SEED Role

"Collagenase and related proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GU94 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Pf6N2E2_5992 Collagenase and related proteases (Pseudomonas fluorescens FW300-N2E2)
MGSLHRMAVLCGLTVLLATATAQAEDWQVAKEKDGIKVSLSEVAGSKYKAYRGVTVMKTT
MAKLRTLQEDVPGACAWIHECKSQKLLKHEGNQSWTYTQFNTPWPVTSRDSVLEVTTEEG
ADGSLTRKLKGVPKYLPEEQGFVRVTQVDGFWKFTPKGAGQIEVTYQVHTEPGGDVPSWL
ANKFVVDAPFNTLKALKERAEK