Protein Info for Pf6N2E2_5968 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): ABC transporter for D-galactose/L-arabinose, substrate-binding component
Rationale: Specifically important for utilizing D-galactose and L-arabinose
Original annotation: L-arabinose-binding periplasmic protein precursor AraF (TC 3.A.1.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 33 to 325 (293 residues), 178.4 bits, see alignment E=2.2e-56 PF13407: Peripla_BP_4" amino acids 34 to 304 (271 residues), 70.9 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 59% identical to ARAF_ECOLI: L-arabinose-binding periplasmic protein (araF) from Escherichia coli (strain K12)

KEGG orthology group: K10537, L-arabinose transport system substrate-binding protein (inferred from 95% identity to pba:PSEBR_a4035)

MetaCyc: 59% identical to arabinose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose-binding periplasmic protein precursor AraF (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4E4 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Pf6N2E2_5968 ABC transporter for D-galactose/L-arabinose, substrate-binding component (Pseudomonas fluorescens FW300-N2E2)
MKHRRGIRSLCRAALAVTAVSLSSHLLAADAVKIGFLVKQAEEPWFQTEWAFAEKAAKDK
GFQLIKIAVPDGEKTLSAIDSLAANGAKGFVICPPDVSLGPAIVAKAKLNDMKVIAVDDR
FVGSDGKFMEDVPYLGMAAFEVGQKQGGAMAAEAKKRGWDWKDTYAVINTYNELDTGKKR
TDGSVDALKKAGMPADHILYSALKTLDVPGSMDSTNSALVKLPSAAKNLIIGGMNDNTVL
GGVRATEAAGFKAANVIGIGINGTDAIGELKKPDSGFFGSMLPSPHIEGYKTAEMMYEWI
TTGKEPPKYTAMDEVTLITRENFKQELEKIGLWN