Protein Info for Pf6N2E2_5964 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG003620: Proteophosphoglycan precursor (Fragment)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF06938: DUF1285_N" amino acids 21 to 87 (67 residues), 123.3 bits, see alignment E=2.6e-40 PF21028: DUF1285_C" amino acids 88 to 182 (95 residues), 134.9 bits, see alignment E=9.6e-44

Best Hits

KEGG orthology group: K09986, hypothetical protein (inferred from 100% identity to pba:PSEBR_a4039)

Predicted SEED Role

"FIG003620: Proteophosphoglycan precursor (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H575 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Pf6N2E2_5964 FIG003620: Proteophosphoglycan precursor (Fragment) (Pseudomonas fluorescens FW300-N2E2)
MSGPQKANDLLGQIPKTKGLPPVHLWNPDFCGDIDMRIARDGTWYYLGTPIGRKPMVKLF
STIIRRDGDDYFLITPVEKVGIKVDDAPFVAVTLEVEGQGEGQLLRFTTNVEETTEAGGE
HPLRVVIDPQTQEPAPYVHVRSNLEALIHRNVFYQLVELAVSREIDGQRWLGVWSGGEFF
PIGLEP