Protein Info for Pf6N2E2_5947 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG146278: Maf/YceF/YhdE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF02545: Maf" amino acids 3 to 184 (182 residues), 166.2 bits, see alignment E=3.4e-53 TIGR00172: septum formation protein Maf" amino acids 3 to 184 (182 residues), 160.2 bits, see alignment E=1.9e-51

Best Hits

Swiss-Prot: 90% identical to NTPPB_PSEPF: 7-methyl-GTP pyrophosphatase (Pfl01_4162) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a4055)

MetaCyc: 54% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"FIG146278: Maf/YceF/YhdE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZSM8 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Pf6N2E2_5947 FIG146278: Maf/YceF/YhdE family protein (Pseudomonas fluorescens FW300-N2E2)
MLPLLLASSSVYRRELLARLGLPFVCCSPDIDESRRPGEPALELVKRLAREKALALADSH
PAHLIIGSDQVAVLGERILGKPHTFENAREQLLAASGARVTFLTGLALLNSQTGHCQVDC
VPFTVNMRALDPGRVERYLRAEQPYDCAGSFKAEGLGVSLFQSTEGPDATSLVGLPLIRL
VDMLLAEGVQIP