Protein Info for Pf6N2E2_5926 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized glutathione S-transferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF02798: GST_N" amino acids 2 to 74 (73 residues), 50.2 bits, see alignment E=6.7e-17 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 48 bits, see alignment E=3.7e-16 PF13417: GST_N_3" amino acids 10 to 78 (69 residues), 47.2 bits, see alignment E=5.7e-16 PF00043: GST_C" amino acids 122 to 196 (75 residues), 25.8 bits, see alignment E=2.6e-09 PF13410: GST_C_2" amino acids 127 to 191 (65 residues), 28.3 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 45% identical to GSTB_SHIFL: Glutathione S-transferase GstB (gstB) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4075)

MetaCyc: 45% identical to glutathione S-transferase GstB (Escherichia coli K-12 substr. MG1655)
RXN0-6549

Predicted SEED Role

"Uncharacterized glutathione S-transferase-like protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZSC7 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Pf6N2E2_5926 Uncharacterized glutathione S-transferase-like protein (Pseudomonas fluorescens FW300-N2E2)
MLKIWGRKNSSNVRKALWCAEELGLAYEAIDAGGAFGVVDTPEYRAKNPNGRVPMIEDDG
FVLWESNTIVRYLAARHASGSAWYPASVQARAQAEKWMDWTTSSFAAPFRTVFWGVLRTP
AEQQDWAAINAAIKDCDDLLAMVEQTLSEQPYLSGDEIGMGDIPLGSFIYAWFEMPIQRA
ELPAVQAWYARLQQRPAYRKAVMTALT