Protein Info for Pf6N2E2_5917 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type II/IV secretion system protein TadC, associated with Flp pilus assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details PF00482: T2SSF" amino acids 179 to 306 (128 residues), 71.6 bits, see alignment E=3e-24

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 96% identity to pba:PSEBR_a4085)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GU57 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Pf6N2E2_5917 Type II/IV secretion system protein TadC, associated with Flp pilus assembly (Pseudomonas fluorescens FW300-N2E2)
MDFLLGLLSRFTGNEELARLLFIAAIGLSTVLAAVALLLLMLGLQDPVQRRLALIKRGYA
GSTTGQEAPGNLQLLLERIGQRFASTDQAHTSATQTLLTHAGYRSASAVQMYWAVRLMLP
LLLVGIALLLLPMVKVSVAIGLLAVTLIAGIGWLLPAIYVGKRKQARQGRLRAAFPDALD
LMVVCVESGLALPTTIERVAEEMSVSQVELAEELALVNAQIRAGITSTEALKQLAVRTGL
EDIQGLVSLLAQSIRFGTSVADTLRIYADEFRDRRTQAAEEMGAKIGTKLIFPLIFCLWP
SFFLVAIGPAMIGVFRAFGNM