Protein Info for Pf6N2E2_5915 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF00437: T2SSE" amino acids 122 to 404 (283 residues), 222 bits, see alignment E=1e-69 PF27713: UCP018868" amino acids 221 to 415 (195 residues), 30.8 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 98% identity to pba:PSEBR_a4087)

Predicted SEED Role

"Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZS88 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Pf6N2E2_5915 Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily (Pseudomonas fluorescens FW300-N2E2)
MISDFRNRLRKQPSKSGASAGTQPEDGLPDPTDALMAWEQAIPDVLYETRSQVTPVEAEW
REKIYQQLLKVMDLSLLDTLEQAEAARQIREICQRLLEEHSAPVSTVSRQLIIKQITDEV
LGLGPLEPLLADHSVSDILVNGFASVYVERFGKLQRTDVRFRDDQHLLNIIDRIVSSLGR
RIDESSPLVDARLKDGSRVNAIIPPLAIDGPSMSIRRFAVDLLNTDSLIQVGTMTPAIAL
LLKAIVRGRLNVLISGGTGSGKTTMLNVLSSFIPHNERIVTIEDSAELQLQQPHVVRLET
RPSNIEGRGEVSQRELVRNSLRMRPDRIVIGEVRGAEAMDMLTAMNTGHDGSLTTIHANT
ARDALGRIENMVSMTGATFPIKAMRQQIASAIDVVIQLERQEDGKRRVVSMQEINGMEGE
IITMTEIFSFVRQGIGEHGEVLGEYRPSGMIPAFRDVLAKRGIELPLTLFRPEWMEGRTS