Protein Info for Pf6N2E2_5914 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type II/IV secretion system ATPase TadZ/CpaE, associated with Flp pilus assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF13614: AAA_31" amino acids 147 to 305 (159 residues), 48.4 bits, see alignment E=2.1e-16 PF10609: ParA" amino acids 147 to 203 (57 residues), 29.3 bits, see alignment 1.2e-10 PF06564: CBP_BcsQ" amino acids 148 to 343 (196 residues), 23.2 bits, see alignment E=9.3e-09 PF01656: CbiA" amino acids 149 to 334 (186 residues), 33.3 bits, see alignment E=8.5e-12

Best Hits

KEGG orthology group: K02282, pilus assembly protein CpaE (inferred from 98% identity to pba:PSEBR_a4088)

Predicted SEED Role

"Type II/IV secretion system ATPase TadZ/CpaE, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4B2 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Pf6N2E2_5914 Type II/IV secretion system ATPase TadZ/CpaE, associated with Flp pilus assembly (Pseudomonas fluorescens FW300-N2E2)
MLNTRETPLSTATGRAGLRILISSRDATALRDLQCVCQRMPGLEVSTRLVSNGHVDPLYG
LDRMPDLLLLRVSHLWREELSALLQRPAHERPPMLVCGPLGEQEGMRLAMQAGARDVLPE
PIADTELVAALNRLVTEVRLGNGNEGKLIAVISAKGGSGGTLVACNLAQQLSARAGNTLL
LDMDLQFGSVTHYLDVAQSHSHLEVLQQIDDMDSVALRGFCSHFSPTLHVLGGRAGELCL
PQDAQPEQLDALLQLARTSYDWVVVDLPRQIDHLTGSVLEQVDRVYVVVQQSVSHLRDAS
ALVRILREDLGVRGDQLQIVINRYDKNAAVSLKDIGEALRCTNLSKLPNDFNLVSQSQNT
GVPLGLHAPKAAITAALRDLTEDLVGHQMATDKGLLKRAFNRFFGG