Protein Info for Pf6N2E2_5910 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flp pilus assembly protein RcpC/CpaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR03177: Flp pilus assembly protein CpaB" amino acids 2 to 243 (242 residues), 200.6 bits, see alignment E=1.4e-63 PF08666: SAF" amino acids 21 to 80 (60 residues), 34.5 bits, see alignment E=3.8e-12 PF16976: RcpC" amino acids 88 to 192 (105 residues), 107.2 bits, see alignment E=7e-35

Best Hits

KEGG orthology group: K02279, pilus assembly protein CpaB (inferred from 97% identity to pba:PSEBR_a4092)

Predicted SEED Role

"Flp pilus assembly protein RcpC/CpaB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H519 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Pf6N2E2_5910 Flp pilus assembly protein RcpC/CpaB (Pseudomonas fluorescens FW300-N2E2)
MADAWLSARLNASPDDHLRSVVVATVEIPFGQMVEAQQVTTVRMPMDTIPDDAFDSSEQA
VGKIATFDILRGDIVRGARLSEHLGGSTLASLIAPDKRAISVRVDDVVGVGGFLLPGNRV
DVLATKTTSAGSNSATSRTLLENLRVLAVDQTAGTDKTQPVVVRAVTLEMSATEAELLVT
AQTEGKLQLALRNPLNLEKKAVAVAPPAPAPVMAMAAPLPKPVVQRSAKPQGGAITLIRG
TESSVINVR