Protein Info for Pf6N2E2_5903 in Pseudomonas fluorescens FW300-N2E2

Annotation: 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF01872: RibD_C" amino acids 2 to 200 (199 residues), 156.7 bits, see alignment E=3.5e-50 TIGR00227: riboflavin-specific deaminase C-terminal domain" amino acids 9 to 205 (197 residues), 153.9 bits, see alignment E=2.3e-49

Best Hits

Swiss-Prot: 44% identical to RIB7_AQUAE: 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate reductase (ribD2) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00082, 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC: 1.1.1.193] (inferred from 79% identity to pst:PSPTO_0835)

MetaCyc: 40% identical to pyrimidine nucleotide reductase (Methanocaldococcus jannaschii)
RXN-10057 [EC: 1.1.1.302]

Predicted SEED Role

"5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.193

Use Curated BLAST to search for 1.1.1.193 or 1.1.1.302

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZS37 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Pf6N2E2_5903 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193) (Pseudomonas fluorescens FW300-N2E2)
MKVTVFSQISIDGKLTLGNEASSKPLFQHFDDEDMRFIHKFRGEVDAIMVGRNTIITDDP
QLTNRYESGRNPVRIIPTTSLNFPASAKIFSSPEHTIIATTEEARDHKMVEHIRAHGKEV
LFAGTARVDFKQLFPMLEARGINHIMVEGGGHLNWQVFNLDLVDEIMLMQLPIIIGGSDT
TTLIDGEGFQDIEMTKAFKLHEFEARSHYNFLHFKRDPQQRRAH