Protein Info for Pf6N2E2_5889 in Pseudomonas fluorescens FW300-N2E2

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 200 (193 residues), 190.9 bits, see alignment E=3.6e-60 PF08659: KR" amino acids 10 to 163 (154 residues), 35.6 bits, see alignment E=1.9e-12 PF13561: adh_short_C2" amino acids 14 to 251 (238 residues), 241.2 bits, see alignment E=2.3e-75 PF23441: SDR" amino acids 62 to 250 (189 residues), 37 bits, see alignment E=5e-13

Best Hits

Swiss-Prot: 44% identical to LINC_SPHIB: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (linB) from Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4106)

MetaCyc: 42% identical to cyclohexanol dehydrogenase (Acinetobacter sp. SE19)
Cyclohexanol dehydrogenase. [EC: 1.1.1.245]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.245

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H9J2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Pf6N2E2_5889 Short-chain dehydrogenase/reductase SDR (Pseudomonas fluorescens FW300-N2E2)
MSMTFSGQVAVVTGAAAGIGRATALAFAAEGLKVVVADLDVAGGEGTVQSIRDAGGEAVF
VRCNVTLENDVQQLMDEVIKTYGRLDYAFNNAGIEIEKGKLADGTLDEFDAIMGVNVKGV
WLCMKYQLPLLLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI
RVNAVCPAVIDTDMFRRAYEADPKKGEFANAMHPVGRIGKVEEIASAVLYLCSDGAAFTT
GHSLAVDGGVTAF