Protein Info for Pf6N2E2_5882 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 220 to 250 (31 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 302 to 333 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 10 to 339 (330 residues), 150 bits, see alignment E=5e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a4112)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GM51 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Pf6N2E2_5882 Putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MINNDRLLVQILLLVLFGASLWVMAPFWSALFWGAVLAFASWPLMRLLTRWVNGRESLAA
ALLTVGWMLLVAVPLVWLGFNLADHVRDATAFIKDAQVDGLPEAPTWLAGVPLVGERLVG
IWNSIDQQGAALMVSARPYLGQVGNWLLARSAQIGGGILELTLSIVFVFFFYRDGPRLAV
FVHGLLERLIGDRAGYYIELVAGTVQRVVNGVIGTAAAQAVLALIGFLIAGVPGALVLGI
VTFLLSLIPMGPPLVWIPATAWLAWKGEYGMAVFLGIWGTFIISGVDNVLKPYLISRGGN
LPLVIVLLGVFGGLIAFGFIGLFIGPTLLAVAYSLLTDWSKSQAR