Protein Info for Pf6N2E2_5874 in Pseudomonas fluorescens FW300-N2E2

Annotation: TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 PF07715: Plug" amino acids 36 to 142 (107 residues), 76.7 bits, see alignment E=1.9e-25 PF00593: TonB_dep_Rec" amino acids 230 to 642 (413 residues), 78 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 97% identity to pba:PSEBR_a4120)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZRN5 at UniProt or InterPro

Protein Sequence (694 amino acids)

>Pf6N2E2_5874 TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins (Pseudomonas fluorescens FW300-N2E2)
LALIISPPVLGDDLFVDSQPLPQVLTATRLKQSPAAVPGSMTVLDSELIKASGARDISEL
LRLVPGMMVGNISGNQAAVNYHGTNASEARRMQVLIDGRSVYRAGLATVDWSDIPVAMED
IERIEVFRGPNTVSYGANALMAVVNIITRAPADSHGTRLKITRGQRGISDWYASQGSGWD
GGDLRLSLSGQEDDGFDSDRNGADYRDSRRLNRFNLSVSQTLNEQQSIDWQLNAKDGTNQ
RPYTYHPVFAGITAAGDNSDVIAKDYAGSLRWNLDLDADHSLYVQGSIQHWDRQQTWRAC
DAEVSFSPQLTDLWQLNPYYAEKLARNIPSYISGGAPAGTPQEQALANQVLDQWRNGASQ
TLCGDIDQSTRESRYDLEIQDTLSLSDSLRLVTGANYRYDRADSQTYFNGTLDDTTWRLF
GQLEWRATENWLLQGGAMFEDTRLTGSSLTPRVAVNYLITPRHGLRAVYSEAVRSPDMFE
NNVNWSYQVTNLQPAAFGQNSARYFVQTRGPGNLEQEHMRSRELGYNGYFVDLALAVDVK
LFHDEITGMISEPLRNNQYIASNSNESQFSGAETQVDWRVTSADRLRLTYAYVDAQASTL
LDEQLTARNSGSAGWLRDWGQGWNSALFYYAADALNGYRYERVDTRLARRISLGKASLEL
AGVLQQRLDNQPTTFTDNRYDSRHVVYFSAELSF