Protein Info for Pf6N2E2_5860 in Pseudomonas fluorescens FW300-N2E2

Annotation: Branched-chain amino acid transport system carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 7 to 427 (421 residues), 517.8 bits, see alignment E=1.2e-159 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 13 to 414 (402 residues), 515.7 bits, see alignment E=4.8e-159

Best Hits

Swiss-Prot: 79% identical to BRAZ_PSEAE: Branched-chain amino acid transport system 3 carrier protein (braZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 99% identity to pba:PSEBR_a4135)

MetaCyc: 67% identical to branched chain amino acid transporter BrnQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-126; TRANS-RXN-126A; TRANS-RXN-126B

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GM34 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Pf6N2E2_5860 Branched-chain amino acid transport system carrier protein (Pseudomonas fluorescens FW300-N2E2)
MKVLKGQDILALGFMTFALFVGAGNIIFPPIVGLQSGPHVWMAALGFLITAVGLPVITVV
ALAKVGGAMDALSSPIGKVAGGLLAAVCYLAVGPLFATPRTATVSFEVGLAPLTGESPLA
LFLYSAAYFLLVFFISLYPGRLLDTVGRFLAPLKIIALAVLGIAAFALPAGDIGVATPEY
IAAPFSQGFINGYLTMDTLGALVFGIVIVNAIRSRGVESPALITRYAIIAGLIAGVGLAL
VYVSLFRLGSGSHEVAAGATNGAAVLHAYVQHTFGSLGSGFLAVLISLACLVTAVGLTCA
CAEYFSRVLPLSYKTLVVILAAFSLLVSNLGLTKLIAFSIPVLTAIYPPCIALVALSFCK
DFWHEQGRIVGPVMLVSFLFGLIDALKGAGLADWMPTQLAHLPLSEQGLAWLVPSVMTLA
VAVVCDRLLGKRSEALA