Protein Info for Pf6N2E2_5859 in Pseudomonas fluorescens FW300-N2E2
Annotation: Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to SUCD_PSEAE: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 100% identity to pba:PSEBR_a4136)MetaCyc: 86% identical to succinyl-CoA synthetase subunit alpha (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]
Predicted SEED Role
"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
- adipate degradation (5/5 steps found)
- superpathway of glyoxylate bypass and TCA (10/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
- TCA cycle I (prokaryotic) (8/10 steps found)
- TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
- adipate biosynthesis (4/5 steps found)
- pyruvate fermentation to acetate V (2/3 steps found)
- TCA cycle VIII (Chlamydia) (4/6 steps found)
- TCA cycle II (plants and fungi) (6/9 steps found)
- pyruvate fermentation to acetate VI (1/3 steps found)
- TCA cycle III (animals) (6/10 steps found)
- reductive TCA cycle I (6/11 steps found)
- incomplete reductive TCA cycle (3/7 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
- reductive TCA cycle II (5/12 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
- methylaspartate cycle (9/19 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- C5-Branched dibasic acid metabolism
- Citrate cycle (TCA cycle)
- Propanoate metabolism
- Reductive carboxylate cycle (CO2 fixation)
Isozymes
Compare fitness of predicted isozymes for: 6.2.1.5
Use Curated BLAST to search for 6.2.1.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0D0S3N2 at UniProt or InterPro
Protein Sequence (294 amino acids)
>Pf6N2E2_5859 Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5) (Pseudomonas fluorescens FW300-N2E2) MSVLINKDTKVICQGITGSQGSFHTQQAIEYGTKMVGGVTPGKGGTEHLGLPVFNTVKDA VAATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDELGITLI GPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTCVGIGG DPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKANVTKPVVSYIAGVTAP PGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTGWEMKK