Protein Info for Pf6N2E2_5859 in Pseudomonas fluorescens FW300-N2E2

Annotation: Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 4 to 287 (284 residues), 474.6 bits, see alignment E=5.7e-147 PF02629: CoA_binding" amino acids 6 to 99 (94 residues), 112.4 bits, see alignment E=2.8e-36 PF13607: Succ_CoA_lig" amino acids 145 to 280 (136 residues), 44.1 bits, see alignment E=3.5e-15 PF00549: Ligase_CoA" amino acids 151 to 271 (121 residues), 103.7 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 95% identical to SUCD_PSEAE: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 100% identity to pba:PSEBR_a4136)

MetaCyc: 86% identical to succinyl-CoA synthetase subunit alpha (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D0S3N2 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Pf6N2E2_5859 Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5) (Pseudomonas fluorescens FW300-N2E2)
MSVLINKDTKVICQGITGSQGSFHTQQAIEYGTKMVGGVTPGKGGTEHLGLPVFNTVKDA
VAATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDELGITLI
GPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKANVTKPVVSYIAGVTAP
PGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTGWEMKK