Protein Info for Pf6N2E2_5851 in Pseudomonas fluorescens FW300-N2E2

Annotation: Succinate dehydrogenase cytochrome b-556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 2 to 83 (82 residues), 81.1 bits, see alignment E=3.8e-27 PF01127: Sdh_cyt" amino acids 3 to 79 (77 residues), 62 bits, see alignment E=3e-21

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 77% identity to avn:Avin_29810)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (85 amino acids)

>Pf6N2E2_5851 Succinate dehydrogenase cytochrome b-556 subunit (Pseudomonas fluorescens FW300-N2E2)
MLYALDKSLDSEEGFGQVKACLTSPLAKLVIWGILSALLYHLVAGVRHLIMDMGIGETLE
GGKLGSKIVIAVSVVVIVLAGVWIW