Protein Info for Pf6N2E2_5849 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): large component of pyruvate transporter (actP-like)
Rationale: Important for pyruvate utilization.
Original annotation: Acetate permease ActP (cation/acetate symporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details amino acids 357 to 385 (29 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 431 to 455 (25 residues), see Phobius details amino acids 466 to 489 (24 residues), see Phobius details amino acids 501 to 520 (20 residues), see Phobius details PF00474: SSF" amino acids 65 to 471 (407 residues), 437 bits, see alignment E=3.5e-135 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 65 to 469 (405 residues), 209.8 bits, see alignment E=3.7e-66

Best Hits

Swiss-Prot: 82% identical to ACTP_YERE8: Cation/acetate symporter ActP (actP) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 98% identity to pba:PSEBR_a4146)

MetaCyc: 79% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZRB0 at UniProt or InterPro

Protein Sequence (552 amino acids)

>Pf6N2E2_5849 large component of pyruvate transporter (actP-like) (Pseudomonas fluorescens FW300-N2E2)
MIRRLLALLSIAAFAPGAWAAEALTGAVQKQPLNVAAILMFVAFVGATLYITYWASKKNN
SAADYYAAGGKITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIIL
FLIAERLRNLGKYTFADVASYRLGQTQIRSLSASGSLVVVAFYLIAQMVGAGKLIQLLFG
LDYHVAVILVGILMCLYVLFGGMLATTWVQIIKAVLLLSGASFMALMVMKHVNFDFNMLF
AEAVKVHPKGEAIMSPGGLVKDPISAFSLGLALMFGTAGLPHILMRFFTVSDAKEARKSV
LYATGFIGYFYILTFIIGFGAILLVSTNPAFKDAAGALLGGNNMAAVHLANAVGGSIFLG
FISAVAFATILAVVAGLTLAGASAVSHDLYASVIRKGRVNEKDEIRVSKITTIALAVLAI
TLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMIGGWLGLVSAVGLMI
LGPTIWVQIMGHEKAIFPYEYPALFSMAIAFVGIWFFSITDKSAEGANERALFFPQFVRS
QTGLGASGAVNH