Protein Info for Pf6N2E2_5848 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): small component of pyruvate transporter (yjcH-like)
Rationale: Important for pyruvate utilization. 58% identical to E. coli yjcH.
Original annotation: Putative membrane protein, clustering with ActP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04341: DUF485
  • amino acids 10 to 98 (89 residues), 114.8 bits, E=7.5e-38

Best Hits

Swiss-Prot: 58% identical to YJCH_ECOLI: Inner membrane protein YjcH (yjcH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4147)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

See A0A161H464 at UniProt or InterPro

Protein Sequence (103 amino acids)

>Pf6N2E2_5848 small component of pyruvate transporter (yjcH-like) (Pseudomonas fluorescens FW300-N2E2)
MNDSIYLSIQNSPRFKELVRKREKFAWILSAIMLGLYSGFILLIAYGPHILGAKITPEST
MTWGIPIGVGLILSAFVLTAIYVRRANGEFDDLNNAILKEAQQ