Protein Info for Pf6N2E2_5845 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nucleoside ABC transporter, periplasmic nucleoside-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF04333: MlaA" amino acids 53 to 246 (194 residues), 228 bits, see alignment E=4.3e-72

Best Hits

KEGG orthology group: K04754, lipoprotein (inferred from 98% identity to pba:PSEBR_a4150)

Predicted SEED Role

"Nucleoside ABC transporter, periplasmic nucleoside-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H9G6 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Pf6N2E2_5845 Nucleoside ABC transporter, periplasmic nucleoside-binding protein (Pseudomonas fluorescens FW300-N2E2)
MSAGLAQADNSKANAPVVVDSDGFKEPLSKLKFNPGLDQREFERSTLNALNVYDPLESWN
RRVYHFNYRFDQWVFLPVVDGYRYVTPSFVRTGVSNFFNNLGDVPNLMNSLLQFKGKRSM
ETTARLLLNTTVGIAGLWDPATAMGLPRQSEDFGQTLGFYGVPGGAYFVLPIFGPSNLRD
TSGLLVDYTAESAINYLNVAEVSANHPELLLLRGVDKRYQTSFRYGQLNSPFEYEKVRYV
YTESRKLQIAE