Protein Info for Pf6N2E2_5831 in Pseudomonas fluorescens FW300-N2E2

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 105 to 123 (19 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 458 to 477 (20 residues), see Phobius details PF07690: MFS_1" amino acids 111 to 316 (206 residues), 97.5 bits, see alignment E=1.2e-31 amino acids 311 to 483 (173 residues), 61.2 bits, see alignment E=1.3e-20 PF00083: Sugar_tr" amino acids 137 to 279 (143 residues), 39.7 bits, see alignment E=4.4e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4164)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZXY0 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Pf6N2E2_5831 Major facilitator family transporter (Pseudomonas fluorescens FW300-N2E2)
LLPLGCEADPIKQNAVGLKHLDGRPKGLLRSPAGASSLATKATLPPLQTRRSLQPLTASM
TAINHKACRNIREHFSLTPSFQLIDEIAMSAHSPTSPGSPLTRGMVLLFAFCCGAIVANI
YYAQPIIELIAPDVGLSSTMASLIVSLTQIGYALGLFFLVPLGDLLENRRLMIITTVVAI
ASLLGAAFTDQPNVFLLVSLLVGFSSVSVQVLIPLAAHLAPEQTRGRVVGGIMGGLLLGI
LLARPVSSIVADHFGWRAMFIIAAALMAAISIVLALTVPKRQPDHSASYGQLLGSLGTLL
RQQPLLRQRAFYQACMFATFSLFWTAVPLELSRNHGLSQTEIALFALVGAIGAIAAPIAG
RLADAGHTRIASLLAMLFASLSFLPTFIHPFYSVIGLAVTGVVLDFCVQMNLVLGQRTIY
ALDAKSRSRLNALYMTSIFVGGAFGSSIASAVYEHGGWLWVVIVGSAFPLLALLRFLSTS
RKRSLATA