Protein Info for Pf6N2E2_583 in Pseudomonas fluorescens FW300-N2E2

Annotation: Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 28 to 30 (3 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 160 to 188 (29 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 273 to 300 (28 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 143 to 350 (208 residues), 125.2 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 62% identical to YEJB_ECO57: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli O157:H7

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 99% identity to pba:PSEBR_a3290)

MetaCyc: 62% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVL5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Pf6N2E2_583 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1) (Pseudomonas fluorescens FW300-N2E2)
MLAYIFRRLLLIIPTLFGILLINFVIIQAAPGGPVEQMIAKLEGFEGATSRIAGGGAEVS
VAGSSYRGAQGLDPALVKEIERMYGFDKSAPERLWIMIKNYAHLDFGDSFFRDAKVIDLI
KEKMPVSISLGLWSTLIMYLVSIPLGIAKATRHGSHFDVWTSSAIIVGYAIPSFLFAILL
IVVFAGGSYFDWFPLRGLTSNNFDELSMGGKILDYFWHLALPVTALVIGNFATMTLLTKN
SFLDEINKQYVVTAKAKGLTRHRVLYGHVFRNAMLLVIAGFPSAFIGIFFTGSLLVEVIF
SLDGLGLMSFEAAINRDYPVVFGTLFIFTLLGLVVKLIGDLTYTFVDPRIDFESREH