Protein Info for Pf6N2E2_5810 in Pseudomonas fluorescens FW300-N2E2

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 203 (189 residues), 96.8 bits, see alignment E=6e-32

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4183)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H447 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Pf6N2E2_5810 Homoserine/homoserine lactone efflux protein (Pseudomonas fluorescens FW300-N2E2)
MNLETWLLFSGAALVVILIPGPLSLLMIGNSLNYGLRRSYPAFLGGVIASICLLSASALG
LGALLMASEQLFSALKIVGALYLFYLAWQSWQQSRQPSQGAEVPQAAAVPRFGALFGRAF
VLGASNPKDILFFAAFLPQFLSAEQAFLPQLLIMIATWTVLDLLCKLAYGLGAHGAARYL
RTGKGQSWFNRISAGLFGGAGAASLLSSH