Protein Info for Pf6N2E2_58 in Pseudomonas fluorescens FW300-N2E2
Annotation: tRNA-dihydrouridine synthase C (EC 1.-.-.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to DUSC_PSEPK: tRNA-dihydrouridine(16) synthase (dusC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: K05541, tRNA-dihydrouridine synthase C [EC: 1.-.-.-] (inferred from 98% identity to pba:PSEBR_a3872)Predicted SEED Role
"tRNA-dihydrouridine synthase C (EC 1.-.-.-)" in subsystem Murein hydrolase regulation and cell death (EC 1.-.-.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A165YHY1 at UniProt or InterPro
Protein Sequence (319 amino acids)
>Pf6N2E2_58 tRNA-dihydrouridine synthase C (EC 1.-.-.-) (Pseudomonas fluorescens FW300-N2E2) MQIALAPMEGLVDNILRDVLTRVGGIDWCVTEFIRVNDRLLTPAYFHKLAPELLTGAQTA AGVPLRVQLLGSDPVCLAENAALACELGSQVIDLNFGCPAKTVNKSRGGAVLLKEPELLN QIVEHVRRAVPRHIPVTAKMRLGFDSPDGALVCATALAEGGAAHIVVHARTKVDGYKPPA HWEWIPRVQEVVKVPVFANGDIWSVDDWRRCREISGVEDIMLGRGLVSRPDLARQIAAAR AGEEVVEMSWVELQPMLHDFWVQVVEQLTPRQAPGRLKQWLAMLTRNYPEAVALFSALRR ETDLDAVGHLLGVQRTEAA