Protein Info for Pf6N2E2_5787 in Pseudomonas fluorescens FW300-N2E2

Annotation: Thiamin ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 67 to 92 (26 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 263 (170 residues), 52.4 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to pba:PSEBR_a4201)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZQK9 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Pf6N2E2_5787 Thiamin ABC transporter, transmembrane component (Pseudomonas fluorescens FW300-N2E2)
MSRAEPGSAGLYHRAVVYLLFAILLLPLAGTLIYSIASSWSATVLPSGFTFKWYVQLWSD
PRFLHAFGQSLLVCVGALVLSVVLILPLLFVVHYHFPKLDALMNILILLPFAVPPVVSSV
GLLQLYGSGPLAMVGTPWILIGCYFTVALPFMYRAITNNLQAINLRDLMDAAQLLGASTF
QAAFLVVLPNLRKGLMVALLLSFSFLFGEFVFANILVGTRYETLQVYLNNMRNSSGHFTS
ALVISYFFFVLVLTWAANILNKDKSQ