Protein Info for Pf6N2E2_5784 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG01073969: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details transmembrane" amino acids 66 to 89 (24 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 202 to 233 (32 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details PF09948: DUF2182" amino acids 69 to 258 (190 residues), 218 bits, see alignment E=5.5e-69

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4204)

Predicted SEED Role

"FIG01073969: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4V7 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Pf6N2E2_5784 FIG01073969: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MAEPQAATPSKRLTGEQLLLLLCLLALTALAWLMLLEMARDMSAPGGMADAAMGGMVMPW
SLADALLMFAMWVVMMVGMMLPSTLPMLLIYQQMLRKRMPAPRRHLALLLFGSAYFLVWA
GFALGATALQWALEQLALLSPGMRSTSTALGAGLLLVAGVYQWLPSKAVCLEHCRGPLHF
LLSYWRPDVLGGWRMGLAHGAYCLGCCWALMGLLFVVGVMNLLWVAVIGAFILLEKNLPQ
GLWFSRVCGVLLLGWSLWLLLG