Protein Info for Pf6N2E2_5781 in Pseudomonas fluorescens FW300-N2E2

Annotation: Oxidoreductase, zinc-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 6 to 314 (309 residues), 398.3 bits, see alignment E=1.1e-123 PF08240: ADH_N" amino acids 24 to 82 (59 residues), 34.7 bits, see alignment E=2e-12 PF00107: ADH_zinc_N" amino acids 146 to 265 (120 residues), 65.5 bits, see alignment E=7.4e-22 PF13602: ADH_zinc_N_2" amino acids 197 to 313 (117 residues), 47.8 bits, see alignment E=4.4e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4207)

Predicted SEED Role

"Oxidoreductase, zinc-binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GLX2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Pf6N2E2_5781 Oxidoreductase, zinc-binding (Pseudomonas fluorescens FW300-N2E2)
VKALQGVEGQVVWADEPSPACDVGQVRIRVAAAGLNRADLLQKAGLYPPPPGASQVLGLE
CAGVISEVGPGSSWQVGDRVCALLAGGGMAEEVVVDGRHVLPVPEGLSLTEAAALPEVYG
TAWLNLFQLAALKPGEKVLLHAGASGVGSAAIQLCKAFGNPCWVSVGSTERLAYCEALGA
QGGVVRTDGLESLNDLGPFDVILDPVGGSYAKLNVKLLSVDGRWVLIGLMGGRSTELDLA
QVLGKRIQLLGSTLRSRDEQFKADLISELGQQVWPLFADKRLSPQLAKTFAIKDAEAAFA
ELATNQVSGKLVLVIDESLS