Protein Info for Pf6N2E2_5764 in Pseudomonas fluorescens FW300-N2E2

Annotation: C4-dicarboxylate transporter/malic acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 274 to 299 (26 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details PF03595: SLAC1" amino acids 25 to 363 (339 residues), 322.8 bits, see alignment E=1.3e-100

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4224)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZQG3 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Pf6N2E2_5764 C4-dicarboxylate transporter/malic acid transport protein (Pseudomonas fluorescens FW300-N2E2)
MTCCAAKNRLRPLSHLPGPLEAVRQFTPNWFAVVMGTGVLALALAQWPGNVPGLRLLGEG
LWLFNILLFVVFAGLYTARWLLFFDEARRIFGHSTVSMFFGTIPMGLATIINGFLVFGLP
RWGNGVVPLAEALWWIDVAMSLACGVLIPFLMFTRQEHRIDQMTAVWLLPVVAAEVAAAS
GGLMAPHLADAHGQLVMLVTSYVLWAFSLPVAFSILTILLLRMALHKLPHENMAASSWLA
LGPIGTGALGMLLLGNDAPLIFAANGLSGVGEIAAGLGLIAGITLWGLGLWWMLMALLIT
VRYLRAGIPFNLGWWGFTFPLGVYALTTLKLSELLSLGFFSVFGAVLVVMLVVMWLIVGR
RTVQGAWHGELFVSPCIAGLAK