Protein Info for Pf6N2E2_5762 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 367 to 384 (18 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 345 (331 residues), 71.7 bits, see alignment E=5.4e-24 PF00083: Sugar_tr" amino acids 42 to 117 (76 residues), 30.9 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a4226)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2K5 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Pf6N2E2_5762 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
MSRPASTRASLIFLALTLLGFLAASSAPTPLYHLYQEQLQFSPAVLTLIFGVYAFSLLAA
LLTVGSLSDYLGRKPVIFVALLLNMLAMLLFISADNVAWLISARLIQGFATGMATSVLGA
ALLDFDRRQGPLITSVAPLLGMACGALGCGLLAEFAPRPLQLTYWILLGLFLLQAVYIWR
LAESVSPQPGAWQSLRPTLHVPIQARRALWLILSLNLAAWAVGGFYLSLAPSLVRAATGS
TSNLIGGALVAVLTLTGALSIYTLRNQGADKMLRLAASLLVIGLALVLLAVHGASLPLFF
VGTLVTGSGFGAGFLGALRSIMPLALPHERAGLMSAFYVLSYLAFSLPSLLAGNLTRVFG
LIPTTDGYGAVLIVLSTGALLGLLRQSVKPLGDGVRP