Protein Info for Pf6N2E2_5722 in Pseudomonas fluorescens FW300-N2E2

Annotation: 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-) ## LSU rRNA m(5)U1939

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 23 to 75 (53 residues), 33.5 bits, 9.5e-12
• PF05958: tRNA_U5-meth_tr
  • amino acids 265 to 447 (183 residues), 92.2 bits, E=1e-29
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 271 to 442 (172 residues), 201.7 bits, E=9.4e-64
• PF05175: MTS
  • amino acids 297 to 383 (87 residues), 23.3 bits, E=1.3e-08
• PF13847: Methyltransf_31
  • amino acids 304 to 377 (74 residues), 29.4 bits, E=1.9e-10
• PF13649: Methyltransf_25
  • amino acids 308 to 363 (56 residues), 30.9 bits, 1.1e-10
• PF08241: Methyltransf_11
  • amino acids 309 to 368 (60 residues), 21.8 bits, E=7.3e-08

Best Hits

Swiss-Prot: 89% identical to RLMD_PSEPF: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 99% identity to pba:PSEBR_a4259)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A160A4A3 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Pf6N2E2_5722 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-) ## LSU rRNA m(5)U1939 (Pseudomonas fluorescens FW300-N2E2)
MAKQERGLRFQPSGGSRAPQVPTGKKQRLTIERLANDGRGIAFIEGRTWFVIGALAGEEV
EARVLGAHGKVVEARTERVFLPSELRRAAPCVHAGRCGGCSVQHLPHDEQLALKQRMLAE
QLSRVAGVVPEEWAAPLSGPEFGYRRRARVAVRWDQKAKKLEVGFRAVGSQDIVAIGDCP
VLVQPLQPIMSRLPEMLRRLSKPQALGHVELFAGSSRAVLLRHMAPLSEADLTILKDFCA
FHEAQLWLHGEGEPQPVEPGQALGFRLDAWDLELAYRPGDFIQVNAGVNEAMIAQALQWL
APRAEERVLDLFCGLGNFALPLAQSVRQVVAVEGVQTMVDRAAANAVSNNLNNTAFFQAD
LSQPLADAEWIGEGFSAVLLDPPRDGAFEVVRKLSSLGAKRLVYVSCNPATLARDTVELI
KQGYRLKRAGILDMFPQTAHVEAMALFEASQDGLSD