Protein Info for Pf6N2E2_5709 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein sprT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF10263: SprT-like" amino acids 10 to 107 (98 residues), 83 bits, see alignment E=6.9e-28

Best Hits

Swiss-Prot: 92% identical to SPRT_PSEPF: Protein SprT (sprT) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02742, SprT protein (inferred from 100% identity to pba:PSEBR_a4272)

Predicted SEED Role

"Protein sprT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKL1 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Pf6N2E2_5709 Protein sprT (Pseudomonas fluorescens FW300-N2E2)
MLEQLNTRVEECYQQAESFFKRPFKRPVVSFKLRGQKAGVAHLHENLLRFNPQLYRENAE
DFLKQTVAHEVAHLIAHQLFGERIQPHGEEWQLIMRGVYELPPNRCHTYEIKRRSVTRYI
YKCPCDGSDFPFSAQRHSLVRQGRRYLCRSCRNTLVFSGETRVE