Protein Info for Pf6N2E2_5707 in Pseudomonas fluorescens FW300-N2E2

Annotation: Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 186 to 214 (29 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 263 to 280 (18 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 389 to 401 (13 residues), see Phobius details PF00375: SDF" amino acids 11 to 403 (393 residues), 385.5 bits, see alignment E=1.5e-119

Best Hits

Swiss-Prot: 94% identical to DCTA_PSECL: C4-dicarboxylate transport protein (dctA) from Pseudomonas chlororaphis

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 97% identity to pba:PSEBR_a4274)

MetaCyc: 76% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A458 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Pf6N2E2_5707 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate (Pseudomonas fluorescens FW300-N2E2)
MTTRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPFGDGFIKLIKMVIAPIIFCTVV
SGIGGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNIVQPGVGMHIDVSTLDTSKIA
GFINASKDQSIIAFILNVIPNTIVGAFANGDILQVLMFSVLFGFALHRLGAYGKPVLDFI
DRFAHVMFIIINMIMKLAPIGAFGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFVLVVL
GAICRAHGFSVVKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGY
SFNLDGTSIYLTMAAVFIAQATDTPMDLTHQITLLLVLLLSSKGAAGVTGSGFIVLAATL
SAVGTLPVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDEDQLQTELASGG
RGIADVREDDEQIAAAQIAAAESSAPVTVK