Protein Info for Pf6N2E2_5706 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF12625: Arabinose_bd" amino acids 22 to 203 (182 residues), 165.9 bits, see alignment E=1.7e-52 PF12833: HTH_18" amino acids 253 to 330 (78 residues), 75.6 bits, see alignment E=4.6e-25 PF00165: HTH_AraC" amino acids 294 to 328 (35 residues), 37.9 bits, see alignment 2.1e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4275)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZQ80 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Pf6N2E2_5706 Transcriptional regulator, AraC family (Pseudomonas fluorescens FW300-N2E2)
MRQRTIASHFARAALGGARRQGFDYVPVLQQLGISPELLDEPRARIAPEQFARLLQALWL
ALGDEYLGFGRAASKPGTFAMMCHALIHCRTLGKALQRGLLFYSLFPDAPSLTLEAEGER
VRLVLDDSTLWDPDHFLTESLLVVWHRLASWLIGQRIGLEQATFGYTKPAHGAEYDLLFS
CPLVFEARSSSLLFHSRYLGMPLLQDERTLKHFLERSPADLLSRPDDGHSLSSQLRRLLS
RDTARWPDLDTVAGHLHISPQTLRRHLREEGTSFQELKDQLRRDIAIYHLGRADLSLQQI
AEQLGFSEPSAFHRAFKKWTGLTPGAYREQEN