Protein Info for Pf6N2E2_5697 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 423 (423 residues), 302.1 bits, see alignment E=4.1e-94 PF00460: Flg_bb_rod" amino acids 4 to 33 (30 residues), 32.9 bits, see alignment (E = 7.6e-12) PF07559: FlaE" amino acids 176 to 322 (147 residues), 84.1 bits, see alignment E=2e-27 PF06429: Flg_bbr_C" amino acids 363 to 440 (78 residues), 58.7 bits, see alignment E=7.5e-20

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 76% identity to pfo:Pfl01_4248)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A451 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Pf6N2E2_5697 Flagellar hook protein FlgE (Pseudomonas fluorescens FW300-N2E2)
MSFNIGLSGLYAANKQLDVTGNNIANVATTGFKSSRAEFEDVYSATKLGSGSKTVGNGVR
LANVSQQFGQGDVNNTGNVLDMGIQGQGFFVLSNDGSLSYTRAGTFKTDKEGFITNSDGT
ARLQGYGVDANGKIQNGILTDLRIDTSNLPPQATSLVSSTINLNSTATPITVAFNPTDTA
TFTKQFTTPVYDTQGNQHSMDQYMVKTAGNTWNVYTLIDGRNLNGSAPVAPNAPVPSTMT
FDSNGRLTQVSTPVPPTVPPTVPTPAPTISNDLNLVGWVPGTVTNGTWTANGAGSSTITI
SMANTTQFNADTARSIPAQNGYATGQITNLTIDGSGVLLANFSNNQTKPIGQLALASFTN
EQGLQPVGGTSWKETFASGIPGYDAPETGTLGSIVSNSLEESNVNLTNELVELIKAQSNY
QANAKTISTQSTIMQTIIQMT