Protein Info for Pf6N2E2_5696 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar basal-body rod modification protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF03963: FlgD" amino acids 19 to 90 (72 residues), 82.7 bits, see alignment E=2.6e-27 PF13861: FLgD_tudor" amino acids 100 to 236 (137 residues), 58.4 bits, see alignment E=9.8e-20 PF13860: FlgD_ig" amino acids 122 to 193 (72 residues), 67.3 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 97% identity to pba:PSEBR_a4285)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4U8 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Pf6N2E2_5696 Flagellar basal-body rod modification protein FlgD (Pseudomonas fluorescens FW300-N2E2)
MSVTNTTSGLSLNEILANSSVKTNNTSDTLGAVTGAATGKKELGKDAFLQLLVTQLKNQN
PLEPQDNGEFVAQLAQFSSLEGITTLNETVSGIAGNYNSSQALQASSLVGRSVIAPGDKA
VVDTSKSLNGTVVVPTSVSSVAVKIVDKDGKTVRTIDLGSQNAGNSAFIWDGKNDAGTVV
ESGTYTFAASTTIDGKATSLITNLPATVSSVTISQTGGELMLNLAGLGSIALSKVQTIGM