Protein Info for Pf6N2E2_5694 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar basal-body rod protein FlgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 TIGR01396: flagellar basal-body rod protein FlgB" amino acids 5 to 133 (129 residues), 143.5 bits, see alignment E=2.1e-46 PF00460: Flg_bb_rod" amino acids 11 to 39 (29 residues), 36.9 bits, see alignment 1.4e-13

Best Hits

Swiss-Prot: 45% identical to FLGB_SALTY: Flagellar basal body rod protein FlgB (flgB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02387, flagellar basal-body rod protein FlgB (inferred from 100% identity to pba:PSEBR_a4287)

Predicted SEED Role

"Flagellar basal-body rod protein FlgB" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A587 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Pf6N2E2_5694 Flagellar basal-body rod protein FlgB (Pseudomonas fluorescens FW300-N2E2)
MSISFDKALGIHEQALSFRAQRAEVLANNIANADTPNYKARDLDFSKVLAEQNEKTKNGH
FALNMTNSRHIEAEGLGNGDESLMYRTPMQPSIDQNTVDAQLEQSNYAENSVNFQASFTL
LNSKFKGLVSALRGE