Protein Info for Pf6N2E2_5651 in Pseudomonas fluorescens FW300-N2E2

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 25 (3 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details PF01925: TauE" amino acids 7 to 265 (259 residues), 126.4 bits, see alignment E=7.4e-41

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 76% identity to pfo:Pfl01_4300)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3X2 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Pf6N2E2_5651 Integral membrane protein (Pseudomonas fluorescens FW300-N2E2)
MFYILLACFGCLSGVTAVLFGFGGGFVVVPLVYRMLTVHHTGDVIGESAMHIAVATSTCV
MIVNALVATRKQRRAGQLIRRYLWPFGGFIALGAALGAATATWMSGEIIRYAFIAYLGLT
ILDCLLRRGFLTHTSDAVPRPLATMETALGGTTIGIIATVLGVGGSVMTVPLLRRCGLSM
SQATSMANPLSLPVALAGTVTYMAMAGFTDTDFGPWFIGYIDLLAFVALTLGALLGIRLA
TPWIGRIPDRLHAWVYIGLLVIVMLGISIQ