Protein Info for Pf6N2E2_5644 in Pseudomonas fluorescens FW300-N2E2
Annotation: CTP synthase (EC 6.3.4.2)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 87% identity to pba:PSEBR_a4341)Predicted SEED Role
"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- superpathway of pyrimidine nucleobases salvage (4/4 steps found)
- L-glutamate and L-glutamine biosynthesis (6/7 steps found)
- UTP and CTP de novo biosynthesis (3/3 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-citrulline biosynthesis (6/8 steps found)
- UTP and CTP dephosphorylation I (5/7 steps found)
- superpathway of L-citrulline metabolism (8/12 steps found)
- UTP and CTP dephosphorylation II (1/3 steps found)
- superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 6.3.4.2
Use Curated BLAST to search for 6.3.4.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A161H4U3 at UniProt or InterPro
Protein Sequence (236 amino acids)
>Pf6N2E2_5644 CTP synthase (EC 6.3.4.2) (Pseudomonas fluorescens FW300-N2E2) MEKQRPLHIALVGDHAPQITAHRAIPIALELITRQTGQDIHFQWLATDSIADNSVLNDFN GVWCVPGSPYRSEDGAVQAIRFAREQHRPFLGTCGGFQHAVLEYARNVMGWADAAHGETD PEAKRALLTPLSCALIETIDSLQLDADSLIAKAYGRQMVFEGYHCRFGVNPNFEEDLLNQ RLHPVARDSAGGLRAVELQDHPFFVATLFQPERAALEGRVPPLVSAFVQACARTTP