Protein Info for Pf6N2E2_5633 in Pseudomonas fluorescens FW300-N2E2

Annotation: Aromatic amino acid transport protein AroP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details amino acids 438 to 455 (18 residues), see Phobius details PF00324: AA_permease" amino acids 19 to 465 (447 residues), 427.2 bits, see alignment E=8e-132 PF13520: AA_permease_2" amino acids 23 to 448 (426 residues), 123 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 66% identical to AROP_SALTI: Aromatic amino acid transport protein AroP (aroP) from Salmonella typhi

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to pba:PSEBR_a4351)

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A413 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Pf6N2E2_5633 Aromatic amino acid transport protein AroP (Pseudomonas fluorescens FW300-N2E2)
MSGQNSHSGELKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAICGFIAF
MIMRQLGEMIVEEPVAGSFSHFAHKYWGGFAGFLSGWNCWILYILVGMSELTAVGKYIHY
WAPDIPTWVSAAAFFILINVINLANVKVFGEAEFWFAIIKVVAIVGMIALGSYLLVSGHG
GPQASVTNLWSHGGFFPNGVSGLVMAMAIIMFSFGGLEMLGFTAAEADKPKTVIPKAINQ
VIYRILIFYIGALVVLLSLTPWDSLLSTLNASGDAYSGSPFVQVFSMLGSNTAAHILNFV
VLTAALSVYNSGTYCNSRMLLGMAEQGDAPKVLSKIDKRGVPVRSILASAAVTLVAVLLN
YLIPQHALELLMSLVVATLVINWAMISYSHFKFRQHMNQTHQTPLFKALWYPYGNYICLA
FVVFILGVMLLIPGIQVSVYAIPVWVVFMAVCYWIKNKRSARQELAVAAAAK