Protein Info for Pf6N2E2_5626 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hypothetical YciO protein, TsaC/YrdC paralog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 7 to 200 (194 residues), 204.8 bits, see alignment E=4.1e-65 PF01300: Sua5_yciO_yrdC" amino acids 22 to 198 (177 residues), 156.8 bits, see alignment E=2.1e-50

Best Hits

Swiss-Prot: 59% identical to YCIO_ECOL6: Uncharacterized protein YciO (yciO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07566, putative translation factor (inferred from 98% identity to pba:PSEBR_a4356)

Predicted SEED Role

"Hypothetical YciO protein, TsaC/YrdC paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZXU1 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Pf6N2E2_5626 Hypothetical YciO protein, TsaC/YrdC paralog (Pseudomonas fluorescens FW300-N2E2)
VSQFFQIHPENPQARLIKQAVEIIRSGGVVVYPTDSSYAIGCQIGDKNAVERVRRLRQLD
DKHNFALICSDLSQLGLFAKIDTGTFRLLKAHLPGPYTFILNATREVPRLLLHPKKRTIG
LRVPSHPIALALLAELGEPLMSVTLIMPGETDPLTDPYEMRQILEHQVDLIIDGGFGGMS
ASTVINLADGEPQVVRVGCGDPTPFMVEA