Protein Info for Pf6N2E2_5621 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF06490: FleQ" amino acids 4 to 85 (82 residues), 24.6 bits, see alignment E=4e-09 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 97.6 bits, see alignment E=7.4e-32 PF00486: Trans_reg_C" amino acids 148 to 222 (75 residues), 55.3 bits, see alignment E=8.6e-19

Best Hits

Swiss-Prot: 37% identical to PHOB_SHIDY: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Shigella dysenteriae

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4360)

Predicted SEED Role

"DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2A0 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Pf6N2E2_5621 DNA-binding response regulator (Pseudomonas fluorescens FW300-N2E2)
MSELLLIDDDQELCELLVSWLSQEGFQVRACHDGQSARKALAETAPAAVVLDVMLPDGSG
LELLKQLRSDHPELPVLMLSARGEPLDRILGLELGADDYLAKPCDPRELTARLRAVLRRS
HPTAVSTQIELGDLTFSPVRGVVSIDEQEQALTISESRLLEALLKQPGEPLDKQELAQIA
LGRKLTLYDRSLDMHVSNLRKKIGPHPDGRPRIVALRSRGYYYSL