Protein Info for Pf6N2E2_5616 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): outer membrane component of uptake system, probably for ferrous iron
Rationale: PFam PF07433.7 (DUF1513). In a conserved cofit operon with an efeO-like gene (Pf6N2E2_5617) and an efeB-like gene (Pf6N2E2_5618). Another efeO-like gene (Pf6N2E2_2853) is cofit but not nearby.
Original annotation: putative exported protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07433: DUF1513
  • amino acids 61 to 364 (304 residues), 381.6 bits, E=1.2e-118

Best Hits

KEGG orthology group: K09947, hypothetical protein (inferred from 98% identity to pba:PSEBR_a4366)

Predicted SEED Role

No annotation

Sequence Analysis Tools

See A0A160A3V4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf6N2E2_5616 outer membrane component of uptake system, probably for ferrous iron (Pseudomonas fluorescens FW300-N2E2)
MFRRQVLALGSLLLGAVTLGGWTLFKQKDKHPLLLSARDDGDGKHYAVGYRLDGTRVFAT
QVGQRCHDIINHPTQPIALFVARRPGTESYLIDLRDGALLQTIASLPNRHFYGHAVIHNS
GEWLYATENDTTDPGRGLLGVYRFEGERLVHSGEISTHGIGPHQVSWMPDGETLVVANGG
IRTEAESRVEMNLDAMEPSLVLMQRDGTLLSKETLAQSMNSVRHLGIASDGTIVSGQQFM
GAAHESSELLAIKRPGQPFQAFPLPEEQLQAMGHYTASVAVHSDLRLVALTAPRGNRFFI
WDLDSGEVRLDAPLPDCAGVGAVADGFVVTSGQGRCRYYDCRQTQLVAKPLDLPAGLWDN
HLHLA