Protein Info for Pf6N2E2_5616 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): outer membrane component of uptake system, probably for ferrous iron
Rationale: PFam PF07433.7 (DUF1513). In a conserved cofit operon with an efeO-like gene (Pf6N2E2_5617) and an efeB-like gene (Pf6N2E2_5618). Another efeO-like gene (Pf6N2E2_2853) is cofit but not nearby.
Original annotation: putative exported protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07433: DUF1513" amino acids 61 to 364 (304 residues), 387.3 bits, see alignment E=2.2e-120

Best Hits

KEGG orthology group: K09947, hypothetical protein (inferred from 98% identity to pba:PSEBR_a4366)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3V4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf6N2E2_5616 outer membrane component of uptake system, probably for ferrous iron (Pseudomonas fluorescens FW300-N2E2)
MFRRQVLALGSLLLGAVTLGGWTLFKQKDKHPLLLSARDDGDGKHYAVGYRLDGTRVFAT
QVGQRCHDIINHPTQPIALFVARRPGTESYLIDLRDGALLQTIASLPNRHFYGHAVIHNS
GEWLYATENDTTDPGRGLLGVYRFEGERLVHSGEISTHGIGPHQVSWMPDGETLVVANGG
IRTEAESRVEMNLDAMEPSLVLMQRDGTLLSKETLAQSMNSVRHLGIASDGTIVSGQQFM
GAAHESSELLAIKRPGQPFQAFPLPEEQLQAMGHYTASVAVHSDLRLVALTAPRGNRFFI
WDLDSGEVRLDAPLPDCAGVGAVADGFVVTSGQGRCRYYDCRQTQLVAKPLDLPAGLWDN
HLHLA