Protein Info for Pf6N2E2_5599 in Pseudomonas fluorescens FW300-N2E2

Annotation: Electron transport complex protein RnfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 6 to 187 (182 residues), 64.9 bits, see alignment E=4.9e-22

Best Hits

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 95% identity to pba:PSEBR_a4381)

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3Z4 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Pf6N2E2_5599 Electron transport complex protein RnfA (Pseudomonas fluorescens FW300-N2E2)
MTEIVLTLFSAALINNLVLHWPLGVDPLLAANGRKQVHALGLATACLMLIVGTLGYLIDH
YLLAPSNLVSLRLLAWLSLSVLLIGPLLRLLARWRPAMSFEGLWPLLLGNAGILGVTLLN
GQDDRGLGHAIALSLGAGLGFWLVLGLFDDLRQRTFNNDIPLPFRGLPIQLISAGLMAVA
FLGLRGLVKT