Protein Info for Pf6N2E2_5595 in Pseudomonas fluorescens FW300-N2E2

Annotation: Electron transport complex protein RnfE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 2 to 140 (139 residues), 57.5 bits, see alignment E=9.4e-20

Best Hits

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 90% identity to pba:PSEBR_a4385)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3U0 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Pf6N2E2_5595 Electron transport complex protein RnfE (Pseudomonas fluorescens FW300-N2E2)
LVGASDSLVGALGLWLAWALVLCSHGLAMGLVRQHLAACQRLLASIVLAATLSTCIGLVL
QAWALELYRPLSLYVGWVALSCVALEHEGFFVDSRWPGRLRLAGLFGLLMISLGAVRELI
GNGLPLALLAPGGFILLGLLLAARQAWTAARPHSSVEETPRP